PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2AS_B3BC47BB0.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NF-YB

Protein Properties

Length: 70aa MW: 7977.19 Da PI: 5.082

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AS_B3BC47BB0.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	135.5	1.5e-42	1	70	17	86
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplk+y Traes_2AS_B3BC47BB0.1 1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYMEPLKLY 70 9*******************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.0E-28	1	70	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	3.0E-38	1	70	IPR009072	Histone-fold
Pfam	PF00808	5.2E-22	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.4E-19	19	37	No hit	No description
PROSITE pattern	PS00685	0	22	38	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.4E-19	38	56	No hit	No description
PRINTS	PR00615	3.4E-19	57	70	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF 60 EDYMEPLKLY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_A	3e-35	1	70	22	91	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	GU902789	1e-111	GU902789.1 Triticum monococcum nuclear transcription factor Y subunit B5 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200348.1	3e-46	nuclear transcription factor Y subunit B-10-like
Swissprot	O23310	9e-46	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A1D5V0X0	6e-45	A0A1D5V0X0_WHEAT; Uncharacterized protein
TrEMBL	A0A3B6AU17	6e-45	A0A3B6AU17_WHEAT; Uncharacterized protein
TrEMBL	A0A3B6C2P1	6e-45	A0A3B6C2P1_WHEAT; Uncharacterized protein
TrEMBL	A0A446KS55	6e-45	A0A446KS55_TRITD; Uncharacterized protein
TrEMBL	A0A446M274	6e-45	A0A446M274_TRITD; Uncharacterized protein
TrEMBL	A0A453B4T7	6e-45	A0A453B4T7_AEGTS; Uncharacterized protein
TrEMBL	H9N7V4	6e-45	H9N7V4_HORVU; NF-YB1
TrEMBL	M0YM16	6e-45	M0YM16_HORVV; Uncharacterized protein
STRING	MLOC_70684.1	1e-45	(Hordeum vulgare)
STRING	Traes_2BS_F23D9EA93.1	1e-45	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	4e-48	nuclear factor Y, subunit B3

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]