![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2AS_C2A4AFE6F.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 73aa MW: 8506.68 Da PI: 9.6207 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 128 | 3.5e-40 | 3 | 73 | 2 | 72 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT----- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhner 72
Cq+e+C adlseak+yhrrhkvCe+h+ka+vv+v+gl+qrfCqqCsrfhel efD++krsCrrrLa+hner
Traes_2AS_C2A4AFE6F.1 3 CQAERCGADLSEAKRYHRRHKVCEAHAKAAVVVVAGLRQRFCQQCSRFHELLEFDDQKRSCRRRLAGHNER 73
**********************************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 30.641 | 1 | 73 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 1.5E-33 | 1 | 64 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 2.35E-36 | 1 | 73 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 6.9E-31 | 3 | 73 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
PSCQAERCGA DLSEAKRYHR RHKVCEAHAK AAVVVVAGLR QRFCQQCSRF HELLEFDDQK 60 RSCRRRLAGH NER |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-34 | 3 | 73 | 11 | 81 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP091672 | 6e-78 | FP091672.1 Phyllostachys edulis cDNA clone: bphylf033o15, full insert sequence. | |||
| GenBank | FP094478 | 6e-78 | FP094478.1 Phyllostachys edulis cDNA clone: bphyst005i03, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020152957.1 | 7e-47 | squamosa promoter-binding-like protein 13 | ||||
| Swissprot | Q6Z461 | 1e-36 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A1D5UXY1 | 2e-45 | A0A1D5UXY1_WHEAT; GLW7 | ||||
| TrEMBL | A0A3B6AY45 | 2e-45 | A0A3B6AY45_WHEAT; SBP protein | ||||
| TrEMBL | A0A446KWN6 | 2e-45 | A0A446KWN6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453BFK4 | 2e-45 | A0A453BFK4_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_2BS_186EA570A.1 | 8e-46 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8524 | 32 | 48 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15270.1 | 4e-25 | squamosa promoter binding protein-like 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




