![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2BL_4611C1667.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 90aa MW: 9763.72 Da PI: 7.7513 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 60.7 | 2.9e-19 | 55 | 90 | 2 | 37 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCr 37
++++l+cprC st+tkfCyynnys++qPr++C++Cr
Traes_2BL_4611C1667.1 55 EQQKLECPRCSSTDTKFCYYNNYSTAQPRHYCRTCR 90
6899*******************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 1.3E-16 | 57 | 90 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 18.482 | 59 | 90 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 6.0E-11 | 59 | 90 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MAPASASLLP AAGSKRPFAA DSAPDAAEQE QPLAQVNCGD QESAATKKNG QSQSEQQKLE 60 CPRCSSTDTK FCYYNNYSTA QPRHYCRTCR |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM084351 | 6e-57 | AM084351.1 Hordeum vulgare subsp. vulgare dof3 gene for dof zinc finger protein 3, exons 1-2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020186822.1 | 2e-41 | dof zinc finger protein DOF1.7-like | ||||
| TrEMBL | A0A3B6CGM9 | 1e-57 | A0A3B6CGM9_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446MWV3 | 1e-57 | A0A446MWV3_TRITD; Uncharacterized protein | ||||
| STRING | Traes_2BL_4611C1667.1 | 1e-59 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14047 | 24 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65590.1 | 4e-16 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




