![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DL_03C96BECE.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 64aa MW: 7246.14 Da PI: 6.5055 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 39.9 | 9.7e-13 | 29 | 60 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g+WTt+Ed+ll+d v+q+G g+W+++++ g
Traes_2DL_03C96BECE.1 29 KGPWTTQEDKLLLDHVAQHGEGRWNSVSKLTG 60
79**************************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 8.2E-12 | 23 | 61 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 13.551 | 24 | 64 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.21E-9 | 26 | 60 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.0E-10 | 29 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.64E-6 | 31 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
LRECRAPLMA EAEGQLAACW GKQDDEWRKG PWTTQEDKLL LDHVAQHGEG RWNSVSKLTG 60 TARI |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020160476.1 | 7e-30 | transcription factor MYB3-like | ||||
| TrEMBL | A0A453CEJ9 | 3e-30 | A0A453CEJ9_AEGTS; Uncharacterized protein | ||||
| TrEMBL | M8CHM0 | 8e-30 | M8CHM0_AEGTA; Myb-related protein 305 | ||||
| STRING | Traes_2DL_03C96BECE.1 | 4e-40 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP53918 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G13480.1 | 2e-14 | myb domain protein 79 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




