![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DL_304E62CCE.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 81aa MW: 9398.68 Da PI: 10.456 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.6 | 5.2e-17 | 26 | 70 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
g ++ eE+e +++ lG++ W+ Ia++++ gRt++++k++w++yl
Traes_2DL_304E62CCE.1 26 GMFSREEEETVMSLHATLGNK-WSQIAQHLP-GRTDNEVKNYWNSYL 70
5699*****************.*********.*************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 4.379 | 1 | 19 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-9 | 5 | 31 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 8.53E-24 | 5 | 75 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.254 | 20 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.6E-13 | 24 | 72 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.9E-16 | 26 | 70 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.67E-10 | 28 | 70 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 32 | 71 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
ISGLERNGKS CRLRWINYLR PGLKHGMFSR EEEETVMSLH ATLGNKWSQI AQHLPGRTDN 60 EVKNYWNSYL KKRVEGARSP A |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-21 | 6 | 75 | 40 | 109 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK370513 | 1e-108 | AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020156817.1 | 3e-52 | transcription factor LAF1-like | ||||
| Swissprot | Q9M0K4 | 7e-36 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A1D5UNR2 | 6e-51 | A0A1D5UNR2_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A453CFH3 | 6e-51 | A0A453CFH3_AEGTS; Uncharacterized protein | ||||
| TrEMBL | M8AYF0 | 3e-51 | M8AYF0_AEGTA; Uncharacterized protein | ||||
| STRING | Traes_2DL_304E62CCE.1 | 2e-54 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1707 | 37 | 109 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G25560.1 | 3e-38 | myb domain protein 18 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




