PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2DL_61C443C56.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 199aa MW: 22385.9 Da PI: 6.0792

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2DL_61C443C56.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	104.5	1.4e-32	7	124	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGf+F P+deelv ++L++k++ +++ ++++++ ++++Pw+L+ k+ + ++wyfFs++ + +r++r +g W+ g Traes_2DL_61C443C56.1 7 LPPGFHFFPSDEELVIHFLRRKAALLPCRP-DIVPTLPQNRYDPWELNGKALQAGNQWYFFSQATQ-----SRTSR---NGCWNPIGA 85 79***********************999.89**********966667789**9754.....35555...7**** PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 d++v s +g++vglkktLvf g+ +++kt+Wvmhey+l Traes_2DL_61C443C56.1 86 DEAVSS-GGSHVGLKKTLVFSIGEPFQATKTNWVMHEYHL 124 *9.999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.81E-44	4	162	IPR003441	NAC domain
PROSITE profile	PS51005	39.798	7	163	IPR003441	NAC domain
Pfam	PF02365	2.6E-22	8	124	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MGGSTNLPPG FHFFPSDEEL VIHFLRRKAA LLPCRPDIVP TLPQNRYDPW ELNGKALQAG 60 NQWYFFSQAT QSRTSRNGCW NPIGADEAVS SGGSHVGLKK TLVFSIGEPF QATKTNWVMH 120 EYHLLDGNGG TSSSGSSRKR SHKKKDHPDK ECSNWVVCRV FESSYDSQVS FHEEDMELSC 180 LDEVFLSLDD YDEVSLPKN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-34	6	168	16	170	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-34	6	168	16	170	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-34	6	168	16	170	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-34	6	168	16	170	NO APICAL MERISTEM PROTEIN
3swm_A	4e-34	6	168	19	173	NAC domain-containing protein 19
3swm_B	4e-34	6	168	19	173	NAC domain-containing protein 19
3swm_C	4e-34	6	168	19	173	NAC domain-containing protein 19
3swm_D	4e-34	6	168	19	173	NAC domain-containing protein 19
3swp_A	4e-34	6	168	19	173	NAC domain-containing protein 19
3swp_B	4e-34	6	168	19	173	NAC domain-containing protein 19
3swp_C	4e-34	6	168	19	173	NAC domain-containing protein 19
3swp_D	4e-34	6	168	19	173	NAC domain-containing protein 19
4dul_A	4e-34	6	168	16	170	NAC domain-containing protein 19
4dul_B	4e-34	6	168	16	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269\|PubMed:18069942, ECO:0000269\|PubMed:20458494}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FR819767	0.0	FR819767.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC026 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020165263.1	1e-149	NAC domain-containing protein 104 isoform X1
Swissprot	Q8GWK6	3e-61	NC104_ARATH; NAC domain-containing protein 104
TrEMBL	A0A453C0T5	1e-148	A0A453C0T5_AEGTS; Uncharacterized protein
STRING	Traes_2BL_F4302657F.2	1e-149	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3667	36	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64530.1	4e-62	xylem NAC domain 1

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Zhao C, et al. XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED. New Phytol., 2017. 216(1): p. 76-89 [PMID:28742236] Tang N, et al. Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis. Nat Commun, 2018. 9(1): p. 3884 [PMID:30250259]