![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DL_662837152.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 103aa MW: 11528.3 Da PI: 10.689 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.5 | 8.2e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyey+s
Traes_2DL_662837152.1 10 RIDNSTSRQVTFSKRRNGIFKKAKELGILCDAEVGLVIFSSTGRLYEYAS 59
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.539 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.30E-45 | 2 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 2.49E-33 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELGILCD AEVGLVIFSS TGRLYEYASS 60 SMKSVIDRYG RAKEEQQLVA NPNSELKFFN TFASLLPQPT APP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 8e-22 | 1 | 83 | 1 | 83 | MEF2C |
| 5f28_B | 8e-22 | 1 | 83 | 1 | 83 | MEF2C |
| 5f28_C | 8e-22 | 1 | 83 | 1 | 83 | MEF2C |
| 5f28_D | 8e-22 | 1 | 83 | 1 | 83 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502900 | 1e-140 | AM502900.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM30 (WM30 gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020189046.1 | 6e-59 | MADS-box transcription factor 27-like isoform X1 | ||||
| Swissprot | Q6EP49 | 7e-55 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
| TrEMBL | A0A2X0S7A6 | 1e-57 | A0A2X0S7A6_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B6CAM1 | 2e-57 | A0A3B6CAM1_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B6DF79 | 1e-57 | A0A3B6DF79_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446L6B6 | 1e-57 | A0A446L6B6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446MF81 | 2e-57 | A0A446MF81_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453C536 | 1e-57 | A0A453C536_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453C547 | 7e-58 | A0A453C547_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A9J228 | 1e-57 | A9J228_WHEAT; MIKC-type MADS-box transcription factor WM30 | ||||
| TrEMBL | F2E3K9 | 1e-57 | F2E3K9_HORVV; Predicted protein | ||||
| STRING | Traes_2DL_662837152.1 | 3e-70 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37940.1 | 3e-49 | AGAMOUS-like 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




