PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2DL_70F83D4B9.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 198aa MW: 22492.3 Da PI: 9.1263

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2DL_70F83D4B9.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	169.7	9.3e-53	10	139	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWka 85 +ppGfrFhPtdeel+ +yLkkk+ +k++l evi+evd++k+ePwdL++ ++ + ++ewyfFs++d+ky+tg+r+nrat++g+Wka Traes_2DL_70F83D4B9.1 10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKA 96 69**************************.99**********963433332566************************* PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 tg+dk + + + +++g++ktLvfy+grap+g+k+dW+mheyrle Traes_2DL_70F83D4B9.1 97 TGRDKCIRT-SYRKIGMRKTLVFYRGRAPHGQKSDWIMHEYRLE 139 ****9.8999**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.96E-59	6	161	IPR003441	NAC domain
PROSITE profile	PS51005	57.388	10	161	IPR003441	NAC domain
Pfam	PF02365	7.7E-28	11	138	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 198 aa Download sequence Send to blast
MADFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWDLQERCR 60 IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR 120 GRAPHGQKSD WIMHEYRLEE IDEAQGGTSE DGWVVCRVFK KKCFFKIAGG GEGSSSQSAD 180 AGAGHMAVSS PLGGHDHA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-56	10	162	17	166	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-56	10	162	17	166	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-56	10	162	17	166	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-56	10	162	17	166	NO APICAL MERISTEM PROTEIN
3swm_A	6e-56	10	162	20	169	NAC domain-containing protein 19
3swm_B	6e-56	10	162	20	169	NAC domain-containing protein 19
3swm_C	6e-56	10	162	20	169	NAC domain-containing protein 19
3swm_D	6e-56	10	162	20	169	NAC domain-containing protein 19
3swp_A	6e-56	10	162	20	169	NAC domain-containing protein 19
3swp_B	6e-56	10	162	20	169	NAC domain-containing protein 19
3swp_C	6e-56	10	162	20	169	NAC domain-containing protein 19
3swp_D	6e-56	10	162	20	169	NAC domain-containing protein 19
4dul_A	6e-56	10	162	17	166	NAC domain-containing protein 19
4dul_B	6e-56	10	162	17	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269\|PubMed:20197506}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU971542	0.0	EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020155185.1	1e-147	protein BEARSKIN1
Swissprot	Q9SV87	1e-105	BRN2_ARATH; Protein BEARSKIN2
TrEMBL	M0V6B8	1e-146	M0V6B8_HORVV; Uncharacterized protein
STRING	MLOC_19175.1	1e-147	(Hordeum vulgare)
STRING	Traes_2DL_70F83D4B9.1	1e-148	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP9297	30	46

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G10350.1	3e-89	NAC domain containing protein 70

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Kamiya M, et al. Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis. Development, 2016. 143(21): p. 4063-4072 [PMID:27803060]