![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DL_C964675DE.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 126aa MW: 14620.9 Da PI: 10.3097 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.4 | 1.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+ +++q G g+W++ +++ g+ R++k+c++rw +yl
Traes_2DL_C964675DE.1 14 KGPWTPEEDQKLLSYIEQQGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
Traes_2DL_C964675DE.1 67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 16.81 | 9 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.41E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.8E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.32E-10 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 25.891 | 62 | 116 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.5E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.2E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 6.8E-17 | 67 | 112 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.42E-11 | 69 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MGRSPCCEKE GLKKGPWTPE EDQKLLSYIE QQGHGCWRSL PAKAGLQRCG KSCRLRWTNY 60 LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG 120 IDPVTH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-28 | 12 | 116 | 5 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF951918 | 0.0 | JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020168407.1 | 3e-92 | myb-related protein Myb4-like | ||||
| Swissprot | Q9LE63 | 3e-84 | MY106_ARATH; Transcription factor MYB106 | ||||
| TrEMBL | A0A3B6C869 | 7e-91 | A0A3B6C869_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446L6I1 | 7e-91 | A0A446L6I1_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446MFC9 | 7e-91 | A0A446MFC9_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453C533 | 6e-91 | A0A453C533_AEGTS; Uncharacterized protein | ||||
| TrEMBL | G9DR81 | 6e-91 | G9DR81_WHEAT; MYB transcription factor 16 | ||||
| STRING | BRADI5G12417.1 | 1e-90 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP79 | 38 | 563 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15310.2 | 2e-86 | myb domain protein 16 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




