![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DL_E2E912AFF.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 74aa MW: 8309.32 Da PI: 8.2262 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 43 | 1.4e-13 | 31 | 74 | 1 | 45 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePw 45
lppGfrF P+d+elv++yL kkv++++ + ++ evd++ ePw
Traes_2DL_E2E912AFF.1 31 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAREPW 74
79*************************888.78***********9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.27E-14 | 27 | 74 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 18.156 | 31 | 74 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.5E-8 | 32 | 74 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
LQASSCWSGG QGRRTGRPGG TMGLREIEST LPPGFRFYPS DQELVCHYLY KKVTNERASQ 60 GTLVEVDLHA REPW |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK248480 | 3e-83 | AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003580130.1 | 2e-31 | protein CUP-SHAPED COTYLEDON 1 | ||||
| Refseq | XP_020168520.1 | 1e-31 | protein CUP-SHAPED COTYLEDON 1-like | ||||
| TrEMBL | A0A1D6DH24 | 3e-30 | A0A1D6DH24_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A287IVF4 | 2e-30 | A0A287IVF4_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A446MJ82 | 2e-31 | A0A446MJ82_TRITD; Uncharacterized protein | ||||
| TrEMBL | M7ZGW4 | 7e-31 | M7ZGW4_TRIUA; Protein CUP-SHAPED COTYLEDON 1 | ||||
| STRING | Traes_2DL_E2E912AFF.1 | 4e-49 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14845 | 11 | 21 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61430.1 | 8e-14 | NAC domain containing protein 100 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




