![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DS_58DC1EC72.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 69aa MW: 7959.18 Da PI: 11.4378 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 91.4 | 1.6e-28 | 3 | 69 | 55 | 122 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWv 122
kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + +g+lvg++ktLvfy+grapkg+kt+Wv
Traes_2DS_58DC1EC72.1 3 GKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR-RGALVGMRKTLVFYQGRAPKGRKTEWV 69
68**********************************9999.999***********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 30.867 | 1 | 69 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.44E-26 | 2 | 69 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.0E-10 | 6 | 69 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
VGGKEWYFYS LKDRKYATGQ RTNRATVSGY WKATGKDRVV ARRGALVGMR KTLVFYQGRA 60 PKGRKTEWV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-24 | 2 | 69 | 69 | 136 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-24 | 2 | 69 | 69 | 136 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-24 | 2 | 69 | 69 | 136 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-24 | 2 | 69 | 69 | 136 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swm_B | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swm_C | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swm_D | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swp_A | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swp_B | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swp_C | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 3swp_D | 3e-24 | 2 | 69 | 72 | 139 | NAC domain-containing protein 19 |
| 4dul_A | 3e-24 | 2 | 69 | 69 | 136 | NAC domain-containing protein 19 |
| 4dul_B | 3e-24 | 2 | 69 | 69 | 136 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HQ650113 | 4e-88 | HQ650113.1 Triticum aestivum NAC transcription factor 6A (NAC6A) mRNA, complete cds. | |||
| GenBank | HQ650115 | 4e-88 | HQ650115.1 Triticum aestivum NAC transcription factor 6C (NAC6C) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020198650.1 | 9e-43 | NAC domain-containing protein 21/22-like isoform X1 | ||||
| Refseq | XP_020198651.1 | 9e-43 | NAC domain-containing protein 21/22-like isoform X2 | ||||
| Swissprot | Q84TE6 | 3e-39 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
| TrEMBL | M8BK83 | 7e-42 | M8BK83_AEGTA; NAC domain-containing protein 21/22 | ||||
| STRING | EMT22193 | 1e-42 | (Aegilops tauschii) | ||||
| STRING | Traes_5DS_446974FE9.2 | 9e-43 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25067 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56010.2 | 1e-41 | NAC domain containing protein 1 | ||||




