PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2DS_6DAFEC37F.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

GRAS

Protein Properties

Length: 64aa MW: 7042.85 Da PI: 4.7232

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2DS_6DAFEC37F.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	52.8	7.4e-17	1	63	268	331
GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331 +dsle+++p++s+er +Er gr+iv++v+c +e+ er+et++ W +rl++aGF+pvp+se Traes_2DS_6DAFEC37F.1 1 MDSLEESFPKTSNERLALERG-AGRAIVDLVSCPASESMERRETAAAWARRLRSAGFSPVPFSE 63 59*****************.**************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	2.6E-14	1	63	IPR005202	Transcription factor GRAS
PROSITE profile	PS50985	11.86	1	64	IPR005202	Transcription factor GRAS

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 64 aa Download sequence Send to blast
MDSLEESFPK TSNERLALER GAGRAIVDLV SCPASESMER RETAAAWARR LRSAGFSPVP 60 FSED

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5b3h_B	7e-21	1	64	312	375	Protein SHORT-ROOT
5b3h_E	7e-21	1	64	312	375	Protein SHORT-ROOT
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the asymmetric cell division involved in radial pattern formation in roots. Essential for both cell division and cell specification (By similarity). {ECO:0000250}.
UniProt	Transcription factor required for the asymmetric cell division involved in radial pattern formation in roots. Essential for both cell division and cell specification. {ECO:0000269\|PubMed:17446396}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK370979	4e-91	AK370979.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2121H05.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015694703.1	3e-35	PREDICTED: protein SHORT-ROOT 1
Refseq	XP_020176974.1	3e-35	protein SHORT-ROOT 1
Swissprot	A2YN56	3e-34	SHR1_ORYSI; Protein SHORT-ROOT 1
Swissprot	Q8H2X8	4e-34	SHR1_ORYSJ; Protein SHORT-ROOT 1
TrEMBL	A0A0A9VJP7	1e-34	A0A0A9VJP7_ARUDO; Uncharacterized protein
TrEMBL	A0A3B6D9Z1	3e-34	A0A3B6D9Z1_WHEAT; Uncharacterized protein
STRING	Traes_2BS_736EF207B1.2	9e-35	(Triticum aestivum)
STRING	Traes_2DS_6DAFEC37F.1	5e-38	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP51086	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37650.1	5e-15	GRAS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]