![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DS_9698ADBC2.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 96aa MW: 10233.5 Da PI: 11.6273 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 40.8 | 5.5e-13 | 1 | 40 | 13 | 54 |
AP2 13 grWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkle 54
gr++AeIrd s++g +r++lg+fgtae Aa a+++a+++ +
Traes_2DS_9698ADBC2.1 1 GRFAAEIRD-STRG-GARVWLGTFGTAEAAAMAYDQAALSSR 40
89*******.3433.4**********************9755 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54171 | 1.96E-15 | 1 | 51 | IPR016177 | DNA-binding domain |
| Gene3D | G3DSA:3.30.730.10 | 3.3E-20 | 1 | 50 | IPR001471 | AP2/ERF domain |
| SMART | SM00380 | 1.1E-16 | 1 | 55 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 3.4E-8 | 1 | 40 | IPR001471 | AP2/ERF domain |
| PROSITE profile | PS51032 | 17.042 | 1 | 49 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
GRFAAEIRDS TRGGARVWLG TFGTAEAAAM AYDQAALSSR GTATALNFPM ERVQESLHAL 60 GATSTGMDGS PVLALKRRHS KRRRRSKVEI ANDAAT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5wx9_A | 1e-17 | 1 | 51 | 24 | 74 | Ethylene-responsive transcription factor ERF096 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression during the plant development, and/or mediated by stress factors and by components of stress signal transduction pathways. Seems to be a key integrator of ethylene and jasmonate signals in the regulation of ethylene/jasmonate-dependent defenses. Can mediate resistance to necrotizing fungi (Botrytis cinerea and Plectosphaerella cucumerina) and to soil borne fungi (Fusarium oxysporum conglutinans and Fusiarium oxysporum lycopersici), but probably not to necrotizing bacteria (Pseudomonas syringae tomato). {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12060224, ECO:0000269|PubMed:12509529, ECO:0000269|PubMed:15242170, ECO:0000269|PubMed:9851977}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by Pseudomonas syringae tomato (both virulent and avirulent avrRpt2 strains), independently of PAD4. Ethylene induction is completely dependent on functional ETHYLENE-INSENSITIVE2 (EIN2), ETHYLENE-INSENSITIVE3 (EIN3), which is itself a transcription factor and CORONATIVE-INSENSITIVE1 (COI1) proteins. Induction by jasmonate, B.cinerea or F.oxysporum as well as the synergistic induction by ethylene and jasmonate requires EIN2 and COI1. Induction by methyl jasmonate (MeJA) is independent of JAR1. Induction by salicylic acid (SA) is dependent on NPR1 but not on PAD4. Seems not to be induced by Alternaria brassicicola. {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12060224, ECO:0000269|PubMed:12509529, ECO:0000269|PubMed:12805630, ECO:0000269|PubMed:15242170, ECO:0000269|PubMed:9851977}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020192651.1 | 8e-50 | uncharacterized protein LOC109778496 | ||||
| Swissprot | Q8LDC8 | 3e-30 | ERF92_ARATH; Ethylene-responsive transcription factor 1B | ||||
| TrEMBL | A0A3B6D4T2 | 3e-60 | A0A3B6D4T2_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A453AC98 | 1e-60 | A0A453AC98_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_2DS_9698ADBC2.1 | 1e-62 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP277 | 37 | 249 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31230.1 | 6e-18 | ethylene-responsive element binding factor 15 | ||||




