![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DS_B5227B5F6.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 66aa MW: 7957.17 Da PI: 12.218 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 53 | 5.8e-17 | 3 | 63 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
r+R+t+++eq+ +Le+ F++ +p ++e ++ k l + +++V++WFqNrR + ++
Traes_2DS_B5227B5F6.1 3 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 63
89*****************99*************************************997 PP
| |||||||
| 2 | Wus_type_Homeobox | 112.4 | 2.4e-36 | 2 | 65 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
+r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
Traes_2DS_B5227B5F6.1 2 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 65
589***********************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 0.0019 | 1 | 66 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 11.24 | 1 | 64 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 5.13E-14 | 3 | 66 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 8.2E-9 | 3 | 66 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 1.1E-14 | 3 | 63 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
PVRSRWTPKP EQILILESIF NSGMVNPPKD ETVRIRKLLE RFGAVGDANV FYWFQNRRSR 60 SRRRQR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in crown root development (PubMed:26307379, PubMed:29740464). Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system (PubMed:26307379, PubMed:29740464). Regulates the expression of genes required for crown root development, and hormone-responsive genes involved in cytokinin signaling (e.g. RR1, RR2, RR3 and RR4), and auxin signaling (e.g. IAA5, IAA11, IAA23 and IAA31) (PubMed:26307379). Functions dowstream of the auxin biosynthetic genes YUCCA1 in the promotion of crown root development (PubMed:29740464). {ECO:0000269|PubMed:26307379, ECO:0000269|PubMed:29740464}. | |||||
| UniProt | Transcription factor which may be involved in developmental processes. {ECO:0000250}. | |||||
| UniProt | Transcription factor which may be involved in developmental processes. {ECO:0000250}. | |||||
| UniProt | Transcription factor which may be involved in developmental processes. Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system, by regulating the expression of genes required for crown root development and hormone-responsive genes involved in cytokinin (e.g. RR1, RR2, RR3 and RR4) and auxin (e.g. IAA5, IAA11, IAA23 and IAA31) signaling. {ECO:0000250|UniProtKB:Q0D3I7}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK370609 | 4e-97 | AK370609.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2113D12. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008655176.1 | 1e-42 | WUSCHEL-related homeobox 6 | ||||
| Refseq | XP_012699333.1 | 5e-43 | WUSCHEL-related homeobox 11 | ||||
| Swissprot | A2XG77 | 2e-43 | WOX6_ORYSI; WUSCHEL-related homeobox 6 | ||||
| Swissprot | B8B644 | 1e-43 | WOX11_ORYSI; WUSCHEL-related homeobox 11 | ||||
| Swissprot | Q0D3I7 | 1e-43 | WOX11_ORYSJ; WUSCHEL-related homeobox 11 | ||||
| Swissprot | Q10M29 | 3e-43 | WOX6_ORYSJ; WUSCHEL-related homeobox 6 | ||||
| TrEMBL | A0A0D9VTJ0 | 4e-42 | A0A0D9VTJ0_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0D9X313 | 4e-42 | A0A0D9X313_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR03G13850.1 | 7e-43 | (Leersia perrieri) | ||||
| STRING | LPERR07G23470.1 | 6e-43 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1078 | 37 | 109 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G03660.1 | 1e-36 | WUSCHEL related homeobox 11 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




