![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DS_D0563916C.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 50aa MW: 5752.58 Da PI: 11.7781 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 36.9 | 8.1e-12 | 4 | 41 | 13 | 50 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
NR +A+rsR RK+++i eLe+ v +L++e +aL ++
Traes_2DS_D0563916C.1 4 NRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 41
*****************************999987665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd14703 | 3.15E-15 | 1 | 47 | No hit | No description |
| PROSITE profile | PS50217 | 8.634 | 1 | 50 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 4.44E-11 | 2 | 47 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 7.6E-14 | 3 | 48 | No hit | No description |
| Pfam | PF00170 | 9.6E-10 | 3 | 45 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 50 aa Download sequence Send to blast |
ILANRQSAQR SRVRKLQYIS ELERSVTSLQ TEVSALSPRV AFLDHQRSLL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription regulator. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036821 | 2e-61 | BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds. | |||
| GenBank | BT061266 | 2e-61 | BT061266.1 Zea mays full-length cDNA clone ZM_BFb0128B20 mRNA, complete cds. | |||
| GenBank | KJ727557 | 2e-61 | KJ727557.1 Zea mays clone pUT5417 bZIP transcription factor (bZIP117) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002454954.1 | 2e-25 | basic leucine zipper 2 | ||||
| Refseq | XP_004968609.1 | 2e-25 | basic leucine zipper 2 | ||||
| Refseq | XP_014753813.1 | 2e-25 | basic leucine zipper 2 | ||||
| Refseq | XP_015694867.1 | 2e-25 | PREDICTED: basic leucine zipper 2-like | ||||
| Swissprot | Q5QNI5 | 1e-26 | BZP02_ORYSJ; Basic leucine zipper 2 | ||||
| TrEMBL | A0A287KV47 | 3e-25 | A0A287KV47_HORVV; Uncharacterized protein | ||||
| STRING | BRADI2G06790.1 | 3e-25 | (Brachypodium distachyon) | ||||
| STRING | Traes_2DS_D0563916C.1 | 2e-26 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17792 | 7 | 9 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58120.1 | 2e-26 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




