![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2DS_FB1D2D1A7.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 57aa MW: 6251.06 Da PI: 5.597 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 36.8 | 5.7e-12 | 1 | 54 | 319 | 373 |
GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
++ aGF++v+++e+aa +++++l++++ g+ ++ e++ l+l+Wk++++v++SaW
Traes_2DS_FB1D2D1A7.1 1 MRGAGFRAVAFGEEAAGEIRTMLNEHA-AGWGMKREDDDLMLTWKGHNVVFASAW 54
788************************.889999********************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03514 | 2.0E-9 | 1 | 54 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MRGAGFRAVA FGEEAAGEIR TMLNEHAAGW GMKREDDDLM LTWKGHNVVF ASAWAPS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK362740 | 1e-75 | AK362740.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009M24. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020165039.1 | 1e-32 | scarecrow-like protein 32 | ||||
| Swissprot | Q9SN22 | 6e-18 | SCL32_ARATH; Scarecrow-like protein 32 | ||||
| TrEMBL | A0A3B6C330 | 3e-31 | A0A3B6C330_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446KTH2 | 6e-32 | A0A446KTH2_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446M2X2 | 3e-31 | A0A446M2X2_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446M334 | 6e-32 | A0A446M334_TRITD; Uncharacterized protein | ||||
| TrEMBL | M8AQZ0 | 6e-32 | M8AQZ0_TRIUA; Uncharacterized protein | ||||
| STRING | Traes_2BS_FDABA21A7.1 | 4e-32 | (Triticum aestivum) | ||||
| STRING | Traes_2DS_FB1D2D1A7.1 | 3e-34 | (Triticum aestivum) | ||||
| STRING | TRIUR3_31604-P1 | 1e-32 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5697 | 37 | 59 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G49950.1 | 3e-20 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




