PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AL_3160E1F30.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 62aa MW: 7274.21 Da PI: 9.7624

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AL_3160E1F30.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	106.3	1.6e-33	2	57	3	58
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 Dgy+WrKYGqK +k++++prsYY+Ctsa+C++kk+ve+s++dp+++++tYeg+H h Traes_3AL_3160E1F30.1 2 DGYRWRKYGQKFIKNNPHPRSYYKCTSARCSAKKHVEKSTDDPEMLIVTYEGSHLH 57 9*****************************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	28.403	1	60	IPR003657	WRKY domain
SMART	SM00774	2.2E-34	2	59	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	1.4E-31	2	58	IPR003657	WRKY domain
Pfam	PF03106	2.5E-28	2	57	IPR003657	WRKY domain
SuperFamily	SSF118290	1.23E-27	2	59	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MDGYRWRKYG QKFIKNNPHP RSYYKCTSAR CSAKKHVEKS TDDPEMLIVT YEGSHLHGPQ 60 TT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-23	2	57	19	74	Probable WRKY transcription factor 4
2lex_A	1e-23	2	57	19	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK362686	1e-94	AK362686.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009G15.
GenBank	DQ863130	1e-94	DQ863130.1 Hordeum vulgare WRKY transcription factor 36 (WRKY36) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020148292.1	2e-40	WRKY transcription factor WRKY24-like isoform X3
Swissprot	Q9C983	3e-24	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	A0A1D5WHK3	1e-38	A0A1D5WHK3_WHEAT; WRKY transcription factor 49
TrEMBL	A0A3B6EM27	1e-38	A0A3B6EM27_WHEAT; Uncharacterized protein
TrEMBL	A0A446NW31	1e-38	A0A446NW31_TRITD; Uncharacterized protein
TrEMBL	B2KJ86	1e-39	B2KJ86_HORVU; WRKY transcription factor 36 (Fragment)
STRING	MLOC_19031.2	2e-39	(Hordeum vulgare)
STRING	Traes_3AL_3160E1F30.1	6e-41	(Triticum aestivum)
STRING	TRIUR3_34281-P1	5e-39	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP13144	26	33

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	1e-26	WRKY DNA-binding protein 57

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]