![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AL_4769A72F1.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 57aa MW: 6558.66 Da PI: 9.3069 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 58.7 | 1.1e-18 | 1 | 38 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYYrCt+++C+vkk+v+r a+d+ +v++tYeg Hnh+
Traes_3AL_4769A72F1.1 1 RSYYRCTHPTCNVKKQVQRLAKDTAIVVTTYEGVHNHP 38
9************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03106 | 2.8E-13 | 1 | 38 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.22E-14 | 1 | 39 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.3E-15 | 1 | 38 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 16.375 | 1 | 40 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.7E-9 | 1 | 39 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
RSYYRCTHPT CNVKKQVQRL AKDTAIVVTT YEGVHNHPCE KLMEALGPIL KQLQFLS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 3e-88 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020179077.1 | 1e-35 | probable WRKY transcription factor 56 | ||||
| Swissprot | Q8VWQ4 | 1e-29 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| Swissprot | Q9FFS3 | 7e-30 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | A0A3B6EMB5 | 2e-34 | A0A3B6EMB5_WHEAT; Uncharacterized protein | ||||
| STRING | MLOC_54950.1 | 7e-35 | (Hordeum vulgare) | ||||
| STRING | Traes_3AL_4769A72F1.1 | 6e-36 | (Triticum aestivum) | ||||
| STRING | TRIUR3_07596-P1 | 5e-35 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41570.1 | 3e-32 | WRKY DNA-binding protein 24 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




