PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AL_58F294736.2

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 126aa MW: 14256.2 Da PI: 10.6442

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AL_58F294736.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.5	3.9e-15	59	101	5	47
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lkk Traes_3AL_58F294736.2 59 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK 101 69***************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.6E-13	55	113	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.702	57	102	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.06E-12	59	103	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.1E-15	59	102	No hit	No description
Pfam	PF00170	1.6E-13	59	102	IPR004827	Basic-leucine zipper domain
CDD	cd14707	3.16E-24	59	104	No hit	No description
PROSITE pattern	PS00036	0	62	77	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MPIQFVPQPL NVVGPGATLG SAYSDGQSTS PMISPISDSQ TPGRKRGVSG DVPNKFVERR 60 QKRMIKNRES AARSRARKQA YTNELENKVS RLEEENERLK KQKVFSFQYK FTEMPHFSVE 120 VGLPDK

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK373919	1e-149	AK373919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3047H22.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020190743.1	3e-63	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
Refseq	XP_020190744.1	3e-63	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
Swissprot	Q9LES3	9e-31	AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBL	A0A446NSY0	1e-85	A0A446NSY0_TRITD; Uncharacterized protein
STRING	Traes_3AL_58F294736.2	5e-88	(Triticum aestivum)
STRING	Traes_3B_5D3F7382A.1	1e-85	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2707	38	83

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56850.1	4e-33	ABA-responsive element binding protein 3

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655]