![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AL_5EBB7439B.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 99aa MW: 11467.2 Da PI: 10.8899 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 34.3 | 5.3e-11 | 9 | 47 | 4 | 42 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42
kr +r NR +A+rsR RK+++i eLe+ v +L++e
Traes_3AL_5EBB7439B.1 9 PKRVKRILANRQSAQRSRVRKLQYISELERCVTTLQNEV 47
5999********************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 2.1E-14 | 6 | 70 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.53 | 8 | 60 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.06E-12 | 10 | 64 | No hit | No description |
| Pfam | PF00170 | 3.6E-10 | 10 | 54 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.2E-12 | 10 | 64 | No hit | No description |
| CDD | cd14703 | 2.41E-18 | 11 | 62 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 13 | 28 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
SSTETIRDPK RVKRILANRQ SAQRSRVRKL QYISELERCV TTLQNEVSVL SPRVAFLDQQ 60 RTILTVGNSH LKQRIAALAQ DKLFKDAHQE ALKEEIERL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription regulator. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108553 | 1e-100 | AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020195077.1 | 2e-64 | basic leucine zipper 6-like | ||||
| Swissprot | Q5JMK6 | 3e-60 | BZP06_ORYSJ; Basic leucine zipper 6 | ||||
| TrEMBL | M0Y6Q9 | 3e-63 | M0Y6Q9_HORVV; Uncharacterized protein | ||||
| TrEMBL | M7ZPW0 | 7e-64 | M7ZPW0_TRIUA; Transcription factor VIP1 | ||||
| STRING | MLOC_66252.1 | 5e-64 | (Hordeum vulgare) | ||||
| STRING | Traes_3AL_5EBB7439B.1 | 9e-65 | (Triticum aestivum) | ||||
| STRING | TRIUR3_19907-P1 | 1e-64 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1322 | 38 | 125 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58120.1 | 3e-52 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




