PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AL_730255B9F.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

YABBY

Protein Properties

Length: 94aa MW: 10387.8 Da PI: 8.5089

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AL_730255B9F.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	88.6	1.7e-27	46	88	117	159
YABBY 117 rPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 PekrqrvPsaynrfik+eiq ika+nPdi+hreafsaaakn Traes_3AL_730255B9F.1 46 SDPEKRQRVPSAYNRFIKDEIQHIKANNPDITHREAFSAAAKN 88 57****************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47095	6.55E-7	37	86	IPR009071	High mobility group box domain
Pfam	PF04690	1.9E-26	43	88	IPR006780	YABBY protein
CDD	cd00084	1.75E-4	53	80	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
IDCIWTSSGK GLHSSVKICA CFFGMEPTRC TSFTNCSSTL PGSNLSDPEK RQRVPSAYNR 60 FIKDEIQHIK ANNPDITHRE AFSAAAKNVV LQVN

Functional Description ? help Back to Top
Source	Description
UniProt	Seems to be associated with phloem cell differentiation. {ECO:0000269\|PubMed:17676337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP099409	8e-47	FP099409.1 Phyllostachys edulis cDNA clone: bphylf026i14, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018685707.1	7e-20	PREDICTED: protein YABBY 4-like isoform X2
Swissprot	A2X7Q3	1e-19	YAB4_ORYSI; Protein YABBY 4
Swissprot	Q6H668	1e-19	YAB4_ORYSJ; Protein YABBY 4
TrEMBL	A0A3L6EH37	2e-20	A0A3L6EH37_MAIZE; Protein YABBY 4
STRING	Traes_3AL_730255B9F.1	3e-65	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1394	37	121

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26580.2	3e-21	YABBY family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Yang C,Ma Y,Li J The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway. J. Exp. Bot., 2016. 67(18): p. 5545-5556 [PMID:27578842]