![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AL_7C031019E.1 | ||||||||
| Common Name | TRAES_3BF016200140CFD_c1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 112aa MW: 12730.5 Da PI: 10.3223 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 43.1 | 9.5e-14 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
rg+W+ eEd l + v+++ + +W t +++ g++R++k+c++rw++yl
Traes_3AL_7C031019E.1 14 RGPWSREEDAVLRNFVQRFANAgNWITLPQKAGLNRCGKSCRLRWLNYL 62
89******************999*************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 44.7 | 3e-14 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g +T+eEd l++ + G++ W+ Ia++++ gRt++++k++w++
Traes_3AL_7C031019E.1 69 GGFTEEEDSLILSLYGDIGSR-WSVIAAKLP-GRTDNDVKNHWNT 111
569******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 10.801 | 9 | 62 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 1.0E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 8.8E-8 | 13 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.6E-12 | 14 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-21 | 15 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.19E-5 | 16 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 19.262 | 63 | 112 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.5E-6 | 67 | 112 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.0E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-20 | 70 | 111 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.08E-9 | 71 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MGRSPCCDKA SVKRGPWSRE EDAVLRNFVQ RFANAGNWIT LPQKAGLNRC GKSCRLRWLN 60 YLRPALRHGG FTEEEDSLIL SLYGDIGSRW SVIAAKLPGR TDNDVKNHWN TK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 8e-25 | 14 | 111 | 7 | 102 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 1e-67 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020157086.1 | 2e-77 | transcription factor RAX2-like | ||||
| Swissprot | Q9FKL2 | 8e-61 | MYB36_ARATH; Transcription factor MYB36 | ||||
| TrEMBL | A0A3B6EJE6 | 8e-78 | A0A3B6EJE6_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446NP08 | 8e-78 | A0A446NP08_TRITD; Uncharacterized protein | ||||
| STRING | Traes_3B_2D2135570.1 | 8e-80 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP135 | 38 | 412 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G57620.1 | 4e-63 | myb domain protein 36 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




