PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AL_891566958.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 76aa MW: 8599.84 Da PI: 11.5057

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AL_891566958.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30	1.2e-09	7	44	10	47
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++ + k +G+g+W++I+r + +Rt+ q+ s+ qky Traes_3AL_891566958.1 7 RLFLLGLKTYGKGDWRKISRNFVRTRTPTQVASHAQKY 44 5789999******************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.502	1	49	IPR017930	Myb domain
TIGRFAMs	TIGR01557	1.1E-11	5	47	IPR006447	Myb domain, plants
SuperFamily	SSF46689	8.58E-12	6	49	IPR009057	Homeodomain-like
CDD	cd00167	1.53E-7	7	45	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.4E-7	8	44	IPR009057	Homeodomain-like
Pfam	PF00249	3.0E-7	8	44	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MPCSLARLFL LGLKTYGKGD WRKISRNFVR TRTPTQVASH AQKYFIRLSS GTARRSSIHD 60 ITTVHLTDDQ PPSPSQ

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KU857045	1e-114	KU857045.1 Triticum aestivum GID2-A1 protein (gid2-A1) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200806.1	1e-39	F-box protein GID2-like
Swissprot	Q8S9H7	2e-30	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A446P634	4e-49	A0A446P634_TRITD; Uncharacterized protein
STRING	Traes_3AL_891566958.1	6e-50	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP842	30	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58900.1	2e-28	Homeodomain-like transcriptional regulator

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]