![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AL_EF72B5A0D.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 99aa MW: 10908.2 Da PI: 6.7899 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 80.3 | 2.5e-25 | 1 | 47 | 51 | 97 |
NF-YB 51 sdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
sdkcq+ekrktingddllwa+atlGfe+yv+plk+yl+kyr++eg++
Traes_3AL_EF72B5A0D.1 1 SDKCQKEKRKTINGDDLLWAMATLGFEEYVDPLKIYLQKYRDMEGDS 47
89*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.6E-21 | 1 | 57 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.59E-16 | 2 | 54 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 5.7E-12 | 4 | 22 | No hit | No description |
| PRINTS | PR00615 | 5.7E-12 | 23 | 41 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
SDKCQKEKRK TINGDDLLWA MATLGFEEYV DPLKIYLQKY RDMEGDSKLT SKSGEGSVKK 60 DIIGAHSGAT SSNAQAMVQH GGYAQGMGYM QPQYHNGDT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-17 | 1 | 42 | 52 | 93 | NF-YB |
| 4awl_B | 2e-17 | 1 | 42 | 53 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-17 | 1 | 42 | 53 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | GU902788 | 1e-167 | GU902788.1 Triticum monococcum nuclear transcription factor Y subunit B4 mRNA, partial cds. | |||
| GenBank | KJ862215 | 1e-167 | KJ862215.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B4 mRNA, complete cds. | |||
| GenBank | KM078741 | 1e-167 | KM078741.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D4) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020182576.1 | 3e-68 | nuclear transcription factor Y subunit B-2-like | ||||
| Refseq | XP_020182577.1 | 3e-68 | nuclear transcription factor Y subunit B-2-like | ||||
| Swissprot | P25209 | 5e-53 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | G0TEQ6 | 4e-68 | G0TEQ6_TRIMO; Nuclear transcription factor Y subunit B4 (Fragment) | ||||
| STRING | Traes_3AL_EF72B5A0D.1 | 2e-68 | (Triticum aestivum) | ||||
| STRING | Traes_3B_924B78EE5.1 | 2e-68 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 5e-33 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




