![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AL_F326C5B8E.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 98aa MW: 11275.8 Da PI: 9.9397 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 101.8 | 3.9e-32 | 41 | 97 | 2 | 58 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
dDgy+WrKYGqK +k+s++prsYYrCt ++C++kk+ver+ ++p+++++tYeg H h
Traes_3AL_F326C5B8E.1 41 DDGYKWRKYGQKAIKNSPNPRSYYRCTNPRCNAKKQVERAVDEPDTLVVTYEGLHLH 97
8******************************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 27.382 | 35 | 98 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 9.3E-30 | 35 | 97 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.27E-27 | 38 | 97 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.8E-32 | 40 | 97 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 6.1E-26 | 41 | 97 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
GRSKYHYSPS SPVVFSPEKV LGKMENKYTM KIKSCGNGLA DDGYKWRKYG QKAIKNSPNP 60 RSYYRCTNPR CNAKKQVERA VDEPDTLVVT YEGLHLHY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-22 | 39 | 97 | 16 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-22 | 39 | 97 | 16 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 5e-70 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020198801.1 | 3e-68 | probable WRKY transcription factor 48 | ||||
| Swissprot | Q9FHR7 | 6e-36 | WRK49_ARATH; Probable WRKY transcription factor 49 | ||||
| TrEMBL | A0A3B6EVB4 | 9e-67 | A0A3B6EVB4_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B6H722 | 9e-67 | A0A3B6H722_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446P777 | 9e-67 | A0A446P777_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453GWF4 | 8e-67 | A0A453GWF4_AEGTS; Uncharacterized protein | ||||
| STRING | MLOC_7470.1 | 6e-67 | (Hordeum vulgare) | ||||
| STRING | Traes_3AL_F326C5B8E.1 | 4e-68 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP7525 | 35 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G43290.1 | 2e-38 | WRKY DNA-binding protein 49 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




