PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AL_FC5523394.2

Common Name

ABFB

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 122aa MW: 14006.1 Da PI: 10.0084

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AL_FC5523394.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	43	9.7e-14	38	91	5	58
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 +r rr++kNRe+A rsR+RK+a++ eLe + L++eN +Lk e +++ + ++ Traes_3AL_FC5523394.2 38 RRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKAEEKTILLTKKQ 91 689***************************************997776555555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.8E-12	33	98	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.852	36	81	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.7E-14	38	85	No hit	No description
CDD	cd14707	3.79E-19	38	92	No hit	No description
SuperFamily	SSF57959	1.97E-11	38	84	No hit	No description
Pfam	PF00170	2.7E-11	38	90	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	41	56	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MTQADMMNCM GEGAMMENGG TRKRGAPEDQ SCERSIERRH RRMIKNRESA ARSRARKQAY 60 TVELEAELNH LKEENARLKA EEKTILLTKK QMLVEKMIEQ SKENVNAKKG APLSRHCGSC 120 IW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269\|PubMed:17604002, ECO:0000269\|PubMed:18236009, ECO:0000269\|PubMed:21055780, ECO:0000269\|PubMed:22071266}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269\|PubMed:18236009, ECO:0000269\|PubMed:21055780, ECO:0000269\|PubMed:22071266}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF519804	0.0	AF519804.1 Triticum aestivum ABA response element binding factor (ABFB) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020182640.1	2e-77	protein ABSCISIC ACID-INSENSITIVE 5-like
Swissprot	Q8RZ35	4e-53	ABI5_ORYSJ; bZIP transcription factor ABI5 homolog
TrEMBL	A0A446NV75	5e-82	A0A446NV75_TRITD; Uncharacterized protein
TrEMBL	Q8LK78	5e-82	Q8LK78_WHEAT; ABA response element binding factor
STRING	Traes_3AL_FC5523394.2	4e-84	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3830	35	58

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G36270.1	8e-23	bZIP family protein

Publications ? help Back to Top
Johnson RR,Wagner RL,Verhey SD,Walker-Simmons MK The abscisic acid-responsive kinase PKABA1 interacts with a seed-specific abscisic acid response element-binding factor, TaABF, and phosphorylates TaABF peptide sequences. Plant Physiol., 2002. 130(2): p. 837-46 [PMID:12376648] Zou M,Guan Y,Ren H,Zhang F,Chen F A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance. Plant Mol. Biol., 2008. 66(6): p. 675-83 [PMID:18236009] Kim H, et al. A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth. J. Exp. Bot., 2012. 63(2): p. 1013-24 [PMID:22071266] Bhatnagar N, et al. The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10. Plant Mol. Biol., 2017. 93(4-5): p. 389-401 [PMID:28000033]