![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AS_102EBF3DD.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 96aa MW: 11190 Da PI: 8.6974 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 65.1 | 1.4e-20 | 2 | 45 | 49 | 92 |
NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
asdkc +ekrktingddl+w+++tlGfedyveplk++lk y++
Traes_3AS_102EBF3DD.2 2 RASDKCVKEKRKTINGDDLIWSMGTLGFEDYVEPLKLHLKLYQQ 45
59***************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.27E-13 | 2 | 51 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-16 | 2 | 46 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 4.3E-8 | 7 | 25 | No hit | No description |
| PRINTS | PR00615 | 4.3E-8 | 26 | 44 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
RRASDKCVKE KRKTINGDDL IWSMGTLGFE DYVEPLKLHL KLYQQAFEFK RLLLYYNNVH 60 DQQVLLMSSI SYLAIVSAIF TSADMCSGFQ FLHRHG |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 4e-61 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | M8A4C7 | 1e-33 | M8A4C7_TRIUA; Nuclear transcription factor Y subunit B-4 | ||||
| STRING | Traes_3AS_102EBF3DD.2 | 1e-66 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25630 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.8 | 7e-22 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




