PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3AS_794DAF12D.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 98aa MW: 10994.3 Da PI: 11.635

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3AS_794DAF12D.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.5	7.5e-14	22	66	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT +E+ l++ + k +G+g+W+ I+r + +Rt+ q+ s+ qky Traes_3AS_794DAF12D.1 22 PWTDDEHRLFLLGLKTYGKGDWRNISRNFVRTRTPTQVASHAQKY 66 7*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.47	15	71	IPR017930	Myb domain
SuperFamily	SSF46689	2.02E-17	17	71	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-11	19	69	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	3.5E-16	20	69	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	4.8E-11	21	65	IPR009057	Homeodomain-like
CDD	cd00167	1.58E-11	22	67	No hit	No description
Pfam	PF00249	2.3E-11	22	66	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
GVGCGNWHGV RTPGQGRRRG APWTDDEHRL FLLGLKTYGK GDWRNISRNF VRTRTPTQVA 60 SHAQKYFIRL SSGAARRSSI HDITTVHLTD DQPPSPSQ

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KU857036	1e-165	KU857036.1 Triticum aestivum GID2 protein isoform 1 (gid2) mRNA, complete cds.
GenBank	KU857039	1e-165	KU857039.1 Triticum urartu GID2 protein (gid2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200806.1	2e-59	F-box protein GID2-like
Swissprot	Q8S9H7	8e-39	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A173FEF5	2e-65	A0A173FEF5_TRIUA; GID2 protein
STRING	Traes_3AS_794DAF12D.1	5e-67	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP842	30	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58900.1	2e-38	Homeodomain-like transcriptional regulator

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]