![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AS_D8AE0A149.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 90aa MW: 9659.57 Da PI: 4.6885 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 41.3 | 2.8e-13 | 1 | 33 | 53 | 85 |
EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkld 85
+++s++yvltkGW++Fvk+ gL++gD+v F+++
Traes_3AS_D8AE0A149.1 1 WNSSQSYVLTKGWSRFVKETGLRAGDTVAFYRS 33
799****************************54 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd10017 | 1.01E-8 | 1 | 33 | No hit | No description |
| PROSITE profile | PS50863 | 10.489 | 1 | 51 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 5.1E-11 | 1 | 36 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 4.5E-10 | 1 | 33 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 1.7E-12 | 1 | 50 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
WNSSQSYVLT KGWSRFVKET GLRAGDTVAF YRSAYGNDTE DQLFIDYKKM NKNDDAADAA 60 ISNENETGHV AVKLFGVDIA GGGMVGSSGG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wid_A | 7e-15 | 1 | 54 | 71 | 121 | DNA-binding protein RAV1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 1e-141 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020191027.1 | 2e-48 | putative AP2/ERF and B3 domain-containing protein Os01g0140700 | ||||
| Swissprot | Q9AWS7 | 3e-24 | Y1407_ORYSJ; Putative AP2/ERF and B3 domain-containing protein Os01g0140700 | ||||
| TrEMBL | A0A446N2L6 | 3e-58 | A0A446N2L6_TRITD; Uncharacterized protein | ||||
| STRING | Traes_3AS_D8AE0A149.1 | 2e-59 | (Triticum aestivum) | ||||
| STRING | TRIUR3_33405-P1 | 2e-58 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP37111 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G68840.2 | 2e-18 | related to ABI3/VP1 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




