![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3AS_E65C48107.1 | ||||||||
| Common Name | TRAES_3BF059600070CFD_c1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 53aa MW: 5982.65 Da PI: 9.3673 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.6 | 1.4e-13 | 13 | 53 | 1 | 41 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41
+g W++eEde+l+ ++++G tW+++a+ g++R++k+c+
Traes_3AS_E65C48107.1 13 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCR 53
678*************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.12 | 8 | 53 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.8E-10 | 10 | 53 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-13 | 12 | 53 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.4E-11 | 13 | 53 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.84E-6 | 16 | 53 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 53 aa Download sequence Send to blast |
DVGGEVEAHK ERKGLWSPEE DERLYTRITR HGVSTWSSVA QLAGLRRSGK SCR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 4e-69 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020183575.1 | 6e-30 | myb-related protein 305-like | ||||
| Swissprot | P20027 | 1e-15 | MYB3_HORVU; Myb-related protein Hv33 | ||||
| TrEMBL | A0A3B6EF32 | 1e-28 | A0A3B6EF32_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B6GR81 | 1e-28 | A0A3B6GR81_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446N5J6 | 1e-28 | A0A446N5J6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453E366 | 1e-28 | A0A453E366_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453E3A2 | 3e-30 | A0A453E3A2_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_3AS_E65C48107.1 | 9e-31 | (Triticum aestivum) | ||||
| STRING | Traes_3B_3431FB444.1 | 3e-29 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP21121 | 6 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12720.1 | 2e-17 | myb domain protein 67 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




