![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3DL_37D040907.1 | ||||||||
| Common Name | TRAES_3BF026400090CFD_c1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 47aa MW: 5806.81 Da PI: 10.671 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 35.7 | 1.5e-11 | 1 | 24 | 33 | 56 |
HHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 33 LAkklgLterqVkvWFqNrRakek 56
LA kl+L rqV vWFqNrRa+ k
Traes_3DL_37D040907.1 1 LAIKLKLRPRQVEVWFQNRRARTK 24
899*******************98 PP
| |||||||
| 2 | HD-ZIP_I/II | 73 | 5.9e-24 | 1 | 47 | 32 | 78 |
HD-ZIP_I/II 32 lareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeene 78
la +L+l+prqv+vWFqnrRARtk+k++E+++e+Lkr++ +l+een+
Traes_3DL_37D040907.1 1 LAIKLKLRPRQVEVWFQNRRARTKLKHTEMECEYLKRCFGSLTEENR 47
799****************************************9985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE pattern | PS00027 | 0 | 1 | 24 | IPR017970 | Homeobox, conserved site |
| Gene3D | G3DSA:1.10.10.60 | 4.3E-10 | 1 | 33 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 5.7E-9 | 1 | 24 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 12.131 | 1 | 26 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 5.73E-5 | 1 | 27 | No hit | No description |
| SuperFamily | SSF46689 | 3.7E-10 | 1 | 35 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 47 aa Download sequence Send to blast |
LAIKLKLRPR QVEVWFQNRR ARTKLKHTEM ECEYLKRCFG SLTEENR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}. | |||||
| UniProt | Probable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF145727 | 4e-56 | AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020154762.1 | 7e-27 | homeobox-leucine zipper protein HOX3 | ||||
| Swissprot | Q0JKX1 | 1e-26 | HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3 | ||||
| Swissprot | Q9XH38 | 1e-26 | HOX3_ORYSI; Homeobox-leucine zipper protein HOX3 | ||||
| TrEMBL | A0A453F480 | 1e-25 | A0A453F480_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453F4A2 | 2e-25 | A0A453F4A2_AEGTS; Uncharacterized protein | ||||
| TrEMBL | W5CTY7 | 2e-25 | W5CTY7_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_3B_436FBF290.1 | 3e-26 | (Triticum aestivum) | ||||
| STRING | Traes_3DL_37D040907.1 | 9e-27 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G01430.1 | 2e-22 | homeobox-leucine zipper protein 17 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




