 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3DL_3ECFD7555.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 65aa MW: 7719.79 Da PI: 4.4945 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 28.1 | 6.6e-09 | 25 | 64 | 1 | 40 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegk 40
+f n+YA e GFsvrk + + + n +i+ r++vCs+eg
Traes_3DL_3ECFD7555.1 25 EFCNKYALEKGFSVRKGYVEWDEANVKIILRKLVCSREGC 64
5889**********************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 1.2E-6 | 25 | 64 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
VSDECMAEYD DIVIRMFDRE EEGFEFCNKY ALEKGFSVRK GYVEWDEANV KIILRKLVCS 60 REGCR |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020156981.1 | 5e-32 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| Refseq | XP_020183684.1 | 5e-32 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| TrEMBL | A0A453GV99 | 2e-37 | A0A453GV99_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_3DL_3ECFD7555.1 | 1e-39 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2449 | 9 | 76 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|