![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3DL_7B0E46392.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 64aa MW: 7951.03 Da PI: 9.1898 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 45.8 | 2e-14 | 10 | 62 | 1 | 53 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerr 53
+fYn+YA e GFsvrk + + + n++i+ r+fvCs+eg ree++ k+++e r
Traes_3DL_7B0E46392.1 10 EFYNKYALEKGFSVRKGYVEWDEANEKIILRKFVCSREGCREEKHMKRKREDR 62
6******************************************9999444444 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 3.7E-12 | 10 | 62 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MFHSEDEGFE FYNKYALEKG FSVRKGYVEW DEANEKIILR KFVCSREGCR EEKHMKRKRE 60 DRKR |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020150962.1 | 2e-35 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| Refseq | XP_020179994.1 | 2e-35 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| TrEMBL | A0A453MVG2 | 5e-34 | A0A453MVG2_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453MYE8 | 1e-37 | A0A453MYE8_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453PYR9 | 2e-34 | A0A453PYR9_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_1DL_DD0FCDF93.1 | 1e-34 | (Triticum aestivum) | ||||
| STRING | Traes_3DL_7B0E46392.1 | 8e-39 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2449 | 9 | 76 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G28530.1 | 2e-07 | FAR1-related sequence 10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




