PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3DL_DF0D3F3FE.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 90aa MW: 10364.5 Da PI: 8.6356

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3DL_DF0D3F3FE.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	97.1	1.2e-30	5	63	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC vkk+ver+++d ++v+++Yeg Hnh Traes_3DL_DF0D3F3FE.1 5 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCYVKKRVERDKDDANYVVTMYEGVHNHA 63 59********************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	30.251	1	65	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	4.1E-30	2	65	IPR003657	WRKY domain
SuperFamily	SSF118290	2.09E-27	3	65	IPR003657	WRKY domain
SMART	SM00774	5.7E-33	5	64	IPR003657	WRKY domain
Pfam	PF03106	5.8E-24	6	62	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
EEEILDDGYK WRKYGKKSVK NSPNPRNYYR CSTEGCYVKK RVERDKDDAN YVVTMYEGVH 60 NHASPGTVYY AAQDPASGRF FVTGTHHLAP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	6e-23	3	65	12	74	WRKY transcription factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG670306	9e-90	HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020195304.1	4e-62	probable WRKY transcription factor 59 isoform X1
Refseq	XP_020195305.1	4e-62	probable WRKY transcription factor 57 isoform X2
Swissprot	Q93WU9	3e-32	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A453F850	8e-62	A0A453F850_AEGTS; Uncharacterized protein
TrEMBL	A0A453F866	1e-61	A0A453F866_AEGTS; Uncharacterized protein
STRING	Traes_3DL_DF0D3F3FE.1	4e-62	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	1e-34	WRKY DNA-binding protein 51

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]