| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 91.6 | 6.6e-29 | 254 | 304 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQ
Traes_3DS_0E0A747A1.1 254 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQ 304
68************************************************9 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}. |
| UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Wang C, et al.
Involvement of OsSPX1 in phosphate homeostasis in rice. Plant J., 2009. 57(5): p. 895-904 [PMID:19000161] - Zhang Q,Wang C,Tian J,Li K,Shou H
Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol (Stuttg), 2011. 13(1): p. 7-15 [PMID:21143719] - Wu Z,Ren H,McGrath SP,Wu P,Zhao FJ
Investigating the contribution of the phosphate transport pathway to arsenic accumulation in rice. Plant Physiol., 2011. 157(1): p. 498-508 [PMID:21715673] - Chen J, et al.
OsPHF1 regulates the plasma membrane localization of low- and high-affinity inorganic phosphate transporters and determines inorganic phosphate uptake and translocation in rice. Plant Physiol., 2011. 157(1): p. 269-78 [PMID:21753117] - Wang C, et al.
Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves. New Phytol., 2012. 196(1): p. 139-48 [PMID:22803610] - Tian J, et al.
Overexpression of OsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice. J Integr Plant Biol, 2012. 54(9): p. 631-9 [PMID:22805094] - Shen C, et al.
OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.). Plant Cell Environ., 2013. 36(3): p. 607-20 [PMID:22913536] - Brenchley R, et al.
Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] - Wu P,Shou H,Xu G,Lian X
Improvement of phosphorus efficiency in rice on the basis of understanding phosphate signaling and homeostasis. Curr. Opin. Plant Biol., 2013. 16(2): p. 205-12 [PMID:23566853] - Wang S, et al.
Auxin response factor (OsARF12), a novel regulator for phosphate homeostasis in rice (Oryza sativa). New Phytol., 2014. 201(1): p. 91-103 [PMID:24111723] - Shi J, et al.
The paralogous SPX3 and SPX5 genes redundantly modulate Pi homeostasis in rice. J. Exp. Bot., 2014. 65(3): p. 859-70 [PMID:24368504] - Li S,Wang C,Zhou L,Shou H
Oxygen deficit alleviates phosphate overaccumulation toxicity in OsPHR2 overexpression plants. J. Plant Res., 2014. 127(3): p. 433-40 [PMID:24687599] - Zhou Z, et al.
SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] - Zhang K, et al.
Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice. Plant Biotechnol. J., 2016. 14(8): p. 1661-72 [PMID:26806409] - Cao Y, et al.
Identification and expression analysis of OsLPR family revealed the potential roles of OsLPR3 and 5 in maintaining phosphate homeostasis in rice. BMC Plant Biol., 2016. 16(1): p. 210 [PMID:27716044]
|