PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3DS_51A589227.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 95aa MW: 10731.5 Da PI: 10.7969

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3DS_51A589227.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.6	1.4e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Traes_3DS_51A589227.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.8E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.74	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.29E-40	2	69	No hit	No description
SuperFamily	SSF55455	2.35E-30	2	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MGRGRIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 RYGHGQLSSP PQLSQFLVQI GASLLLAFLG QRVGK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	8e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG670306	1e-110	HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018674452.1	3e-37	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Swissprot	Q2QW53	2e-36	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A453ED03	1e-48	A0A453ED03_AEGTS; Uncharacterized protein
STRING	Traes_3DS_51A589227.1	3e-63	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	5e-39	MIKC_MADS family protein

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]