![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3DS_796E4C73A.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 77aa MW: 9018.2 Da PI: 9.4879 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 50.1 | 4.6e-16 | 13 | 65 | 5 | 57 |
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
t+ ++ q++ Le+++ + +yp+ e+ +e A+++gLt +qV++WF+ rR ke++
Traes_3DS_796E4C73A.1 13 TKKSPLQIQMLESFYSEVQYPKPEDLTEYAASVGLTYNQVRIWFKERRRKERR 65
567899*********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 14.382 | 6 | 66 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 2.9E-14 | 8 | 70 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 4.71E-16 | 8 | 72 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 2.0E-13 | 13 | 65 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-16 | 13 | 73 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 6.93E-11 | 13 | 56 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
AKGFLAKSDN AGTKKSPLQI QMLESFYSEV QYPKPEDLTE YAASVGLTYN QVRIWFKERR 60 RKERRHMEAA EVHVETQ |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK373981 | 1e-100 | AK373981.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049P02. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153547.1 | 5e-45 | homeobox-DDT domain protein RLT3-like isoform X1 | ||||
| Refseq | XP_020153548.1 | 5e-45 | homeobox-DDT domain protein RLT3-like isoform X2 | ||||
| TrEMBL | A0A446N6P7 | 2e-49 | A0A446N6P7_TRITD; Uncharacterized protein | ||||
| STRING | Traes_3DS_796E4C73A.1 | 2e-51 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4556 | 33 | 50 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G12750.1 | 3e-11 | Homeodomain-like transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




