![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_3DS_A0676BAEA.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 119aa MW: 13821.7 Da PI: 11.522 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 63.3 | 4.9e-20 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT+eEd+llvd++ ++G g+W++ ar+ g++Rt+k+c++rw++ l
Traes_3DS_A0676BAEA.1 16 RGAWTAEEDLLLVDYISRHGEGRWNSLARCAGLRRTGKSCRLRWLNNL 63
89*******************************************975 PP
| |||||||
| 2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 69 | 112 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
Traes_3DS_A0676BAEA.1 69 RGHITPEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 112
6778******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.319 | 11 | 63 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.21E-31 | 14 | 110 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.0E-15 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.3E-17 | 16 | 63 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.5E-23 | 17 | 70 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.21E-11 | 18 | 63 | No hit | No description |
| PROSITE pattern | PS00175 | 0 | 31 | 40 | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site |
| PROSITE profile | PS51294 | 23.783 | 64 | 118 | IPR017930 | Myb domain |
| SMART | SM00717 | 9.1E-15 | 68 | 116 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.6E-16 | 69 | 112 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-23 | 71 | 116 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.70E-11 | 73 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008152 | Biological Process | metabolic process | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003824 | Molecular Function | catalytic activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MSPAGSSAVT TGDLRRGAWT AEEDLLLVDY ISRHGEGRWN SLARCAGLRR TGKSCRLRWL 60 NNLRPDVRRG HITPEEQLLI LDLHSRWGNR WSKIAQHLPG RTDNEIKNYW RTRVQKHAR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-25 | 7 | 112 | 18 | 122 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF587267 | 1e-118 | EF587267.1 Triticum aestivum R2R3 Myb-like protein (PIMP1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153392.1 | 5e-79 | myb-related protein 305-like | ||||
| Swissprot | Q10MB4 | 2e-65 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | A0A3B6GLD0 | 2e-80 | A0A3B6GLD0_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_3DS_A0676BAEA.1 | 9e-82 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP198 | 38 | 330 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27810.1 | 4e-62 | myb domain protein 21 | ||||




