PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_F6B1E6078.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 63aa    MW: 7753.04 Da    PI: 10.8655
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_F6B1E6078.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.21.6e-232362140
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE CS
                   WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkver 40
                           ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver
  Traes_3DS_F6B1E6078.1 23 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVER 62
                           59*************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.7E-25862IPR003657WRKY domain
SuperFamilySSF1182901.31E-211562IPR003657WRKY domain
PROSITE profilePS5081122.1361863IPR003657WRKY domain
SMARTSM007744.8E-152363IPR003657WRKY domain
PfamPF031065.6E-182462IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
AKARRKVREP RFCFKTMSDV DVLDDGYKWR KYGQKVVKNT QHPRSYYRCT QDKCRVKKRV  60
ERL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-181462856Probable WRKY transcription factor 4
2lex_A3e-181462856Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369001e-84BT036900.1 Zea mays full-length cDNA clone ZM_BFb0146L21 mRNA, complete cds.
GenBankEU9636461e-84EU963646.1 Zea mays clone 265112 mRNA sequence.
GenBankKJ7269081e-84KJ726908.1 Zea mays clone pUT3453 WRKY transcription factor (WRKY45) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455053.28e-42probable WRKY transcription factor 12
RefseqXP_020149424.14e-42probable WRKY transcription factor 13
SwissprotQ9SVB73e-38WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A3B6GMP63e-41A0A3B6GMP6_WHEAT; Uncharacterized protein
STRINGSb03g003640.13e-41(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-40WRKY DNA-binding protein 13