PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_4AL_C2A825B6D.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 81aa MW: 9164.46 Da PI: 10.8445

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_4AL_C2A825B6D.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	68.8	8e-22	42	81	1	40
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkver 40 ldDg++WrKYG+K vk+s++pr+YYrC+ +gC kk+ver Traes_4AL_C2A825B6D.1 42 LDDGFKWRKYGKKAVKNSPNPRNYYRCSAEGCGIKKRVER 81 59*************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.1E-22	30	81	IPR003657	WRKY domain
SuperFamily	SSF118290	8.5E-20	34	81	IPR003657	WRKY domain
PROSITE profile	PS50811	22.974	37	81	IPR003657	WRKY domain
SMART	SM00774	2.8E-12	42	81	IPR003657	WRKY domain
Pfam	PF03106	1.4E-16	43	81	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MAQVSFAGAG DDKHRSEKTI KISARVSAGR IGFRTRSEVE ILDDGFKWRK YGKKAVKNSP 60 NPRNYYRCSA EGCGIKKRVE R

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-21	27	81	2	56	Probable WRKY transcription factor 4
2lex_A	6e-21	27	81	2	56	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK357196	1e-113	AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03.
GenBank	AK367065	1e-113	AK367065.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2050M16.
GenBank	DQ840416	1e-113	DQ840416.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 17 (WRKY17) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020169646.1	5e-53	probable WRKY transcription factor 24
Swissprot	Q8VWQ5	4e-28	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A3B5ZQZ9	4e-52	A0A3B5ZQZ9_WHEAT; Uncharacterized protein
STRING	EMT14792	2e-52	(Aegilops tauschii)
STRING	Traes_4AL_C2A825B6D.1	5e-53	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	2e-30	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]