PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_4AS_03A679D8F.1

Common Name

NFYC-B6

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NF-YC

Protein Properties

Length: 67aa MW: 7506.93 Da PI: 10.7105

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_4AS_03A679D8F.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	46.8	6.4e-15	7	63	19	75
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlk 75 +++P arikki++adedv +i+ +Pvl+s+a elf+ +l s+ + ++ +tl+ Traes_4AS_03A679D8F.1 7 TRFPAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDHSYKITLQSGAKTLN 63 679******************************************999999999986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.19E-15	3	67	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	2.2E-24	3	67	IPR009072	Histone-fold
Pfam	PF00808	3.3E-17	8	67	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MRKKLGTRFP AARIKKIMQA DEDVGKIALA VPVLVSRALE LFLQDLIDHS YKITLQSGAK 60 TLNSFHL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1jfi_A	2e-22	2	67	5	70	Transcription Regulator NC2 alpha chain
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM078730	1e-108	KM078730.1 Triticum aestivum CCAAT-binding transcription factor C (NFYC-B6) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020156751.1	9e-39	dr1-associated corepressor-like
Swissprot	Q14919	3e-20	NC2A_HUMAN; Dr1-associated corepressor
TrEMBL	A0A0A7LUP0	4e-39	A0A0A7LUP0_WHEAT; CCAAT-binding transcription factor C
TrEMBL	A0A446QXJ7	4e-39	A0A446QXJ7_TRITD; Uncharacterized protein
TrEMBL	A0A453HYT8	1e-39	A0A453HYT8_AEGTS; Uncharacterized protein
STRING	Traes_4AS_03A679D8F.1	1e-41	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2172	36	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G12480.1	7e-35	nuclear factor Y, subunit C11

Publications ? help Back to Top
Qu B, et al. A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input. Plant Physiol., 2015. 167(2): p. 411-23 [PMID:25489021]