![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4BL_13069CE63.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 95aa MW: 10676 Da PI: 7.3656 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 23.1 | 1.4e-07 | 23 | 62 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L++llP+a ++ ++s + +L++++ YI+sL
Traes_4BL_13069CE63.1 23 QISDLVSKLQDLLPEARLRGNDRVSSSRVLQETCTYIRSL 62
789999*********889********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.896 | 8 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 5.0E-8 | 9 | 81 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 7.07E-9 | 22 | 84 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 8.7E-5 | 23 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MRLTQAPQSR SRQSGSSRIT DEQISDLVSK LQDLLPEARL RGNDRVSSSR VLQETCTYIR 60 SLHREVDDLS ERLSELLATS DMSSAQAAII RSLLM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK069569 | 5e-82 | AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020177249.1 | 1e-45 | transcription factor ILI6 | ||||
| Swissprot | B8APB5 | 2e-44 | ILI6_ORYSI; Transcription factor ILI6 | ||||
| Swissprot | Q0DUR2 | 2e-44 | ILI6_ORYSJ; Transcription factor ILI6 | ||||
| TrEMBL | A0A3B6IV13 | 7e-52 | A0A3B6IV13_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_4BL_13069CE63.1 | 4e-59 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2675 | 33 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 2e-34 | bHLH family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




