PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_27B9E4CE6.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 86aa    MW: 9729.15 Da    PI: 6.2422
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_27B9E4CE6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM71.13e-221783370
                    NAM  3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyat 70
                           pGfrFhPt+eel+ +yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ +
  Traes_4BL_27B9E4CE6.1 17 PGFRFHPTEEELLGFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGS 83
                           9*************************99.99***************888999************9875 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-26985IPR003441NAC domain
PROSITE profilePS5100524.981586IPR003441NAC domain
PfamPF023654.6E-101782IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MAMAVAASTM EVDQDLPGFR FHPTEEELLG FYLSRVALGK KLHFDIIGTL NIYRHDPWDL  60
PGMAKIGERE WYFFVPRDRK AGSGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-2217851785Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3673761e-102AK367376.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2055P15.
GenBankAK3679631e-102AK367963.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2065K10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190294.13e-56NAC domain-containing protein 72-like
SwissprotQ10S652e-50NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3B6IWH57e-55A0A3B6IWH5_WHEAT; Uncharacterized protein
TrEMBLA0A3B6JNX97e-55A0A3B6JNX9_WHEAT; Uncharacterized protein
TrEMBLA0A446SGT04e-56A0A446SGT0_TRITD; Uncharacterized protein
TrEMBLA0A453J3817e-55A0A453J381_AEGTS; Uncharacterized protein
TrEMBLA0A453J3M74e-55A0A453J3M7_AEGTS; Uncharacterized protein
STRINGTraes_4BL_27B9E4CE6.16e-58(Triticum aestivum)
STRINGTraes_4DL_7CB8EC5A8.18e-57(Triticum aestivum)
STRINGTRIUR3_32216-P12e-55(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148451121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.13e-38NAC domain containing protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]