![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4BL_F3AB558D4.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 91aa MW: 10093.1 Da PI: 9.2281 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 45 | 2.8e-14 | 46 | 91 | 2 | 47 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkh 47
Fl+k+y++++d+++++++sw++ gnsfv++d + f++++L+++Fkh
Traes_4BL_F3AB558D4.1 46 FLTKVYDMVSDAATDKVMSWTDAGNSFVIWDAHAFERDLLSRHFKH 91
9********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.8E-15 | 39 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 0.0031 | 42 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 5.71E-12 | 43 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 6.0E-11 | 46 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-6 | 46 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-6 | 84 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
GFRSPHRHGL QQRLAXXXXX XXXXSSAGNA PAPVGPAPRP PEVAPFLTKV YDMVSDAATD 60 KVMSWTDAGN SFVIWDAHAF ERDLLSRHFK H |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK362997 | 2e-69 | AK362997.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2012C04. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020148069.1 | 2e-40 | heat stress transcription factor A-9-like | ||||
| Refseq | XP_020148070.1 | 2e-40 | heat stress transcription factor A-9-like | ||||
| Swissprot | Q10PR4 | 2e-22 | HSFA9_ORYSJ; Heat stress transcription factor A-9 | ||||
| TrEMBL | A0A3B6IV77 | 1e-39 | A0A3B6IV77_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446SAG7 | 1e-39 | A0A446SAG7_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446SAN6 | 1e-39 | A0A446SAN6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446SAQ3 | 1e-39 | A0A446SAQ3_TRITD; Uncharacterized protein | ||||
| STRING | Traes_4BL_F3AB558D4.1 | 1e-52 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26150.1 | 5e-16 | heat shock transcription factor A2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




