![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4BL_F6827247E.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 85aa MW: 9560.81 Da PI: 9.0255 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 65.3 | 8.9e-21 | 4 | 57 | 34 | 87 |
SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
+ l +ed +g++W+++++y+++s +yvltkGW++Fv+++gL +gD+vvF+ ++
Traes_4BL_F6827247E.1 4 VLLNFEDGEGKVWRFRYSYWNSSLSYVLTKGWSRFVREKGLVAGDVVVFSCSEY 57
56899********************************************96654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 13.324 | 1 | 71 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 1.8E-22 | 2 | 69 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.83E-18 | 4 | 66 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 3.5E-18 | 4 | 57 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 4.20E-16 | 8 | 52 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
DKAVLLNFED GEGKVWRFRY SYWNSSLSYV LTKGWSRFVR EKGLVAGDVV VFSCSEYGQE 60 KHFFIDYKKT TTVSGGAAAS PPPVV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wid_A | 6e-27 | 2 | 71 | 50 | 118 | DNA-binding protein RAV1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 9e-59 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020164922.1 | 5e-49 | AP2/ERF and B3 domain-containing protein Os01g0141000-like | ||||
| Swissprot | Q0DXB1 | 3e-33 | Y2641_ORYSJ; B3 domain-containing protein Os02g0764100 | ||||
| Swissprot | Q9AWS0 | 5e-32 | Y1410_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0141000 | ||||
| TrEMBL | A0A446SGL2 | 2e-55 | A0A446SGL2_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446SGL7 | 2e-54 | A0A446SGL7_TRITD; Uncharacterized protein | ||||
| STRING | Traes_4BL_F6827247E.1 | 2e-56 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP15159 | 13 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G68840.2 | 8e-28 | related to ABI3/VP1 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




