PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_4BL_F7B9CBA99.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 87aa MW: 9983.48 Da PI: 10.7131

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_4BL_F7B9CBA99.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.3	3e-17	5	52	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed ll ++v+q G g+W+++a+ g++R++k+c++rw +yl Traes_4BL_F7B9CBA99.1 5 KGPWTALEDRLLTEYVQQQGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 52 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.646	1	56	IPR017930	Myb domain
SMART	SM00717	1.8E-13	4	54	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.0E-21	4	55	IPR009057	Homeodomain-like
Pfam	PF00249	3.3E-16	5	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.3E-23	6	81	IPR009057	Homeodomain-like
CDD	cd00167	1.32E-9	7	52	No hit	No description
PROSITE profile	PS50090	4.693	53	80	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	8.6E-9	56	80	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
GAWRKGPWTA LEDRLLTEYV QQQGEGSWNS VAKLTGLRRS GKSCRLRWVN YLRPDLKRGK 60 ITADEETVIL QLHAMLGNSW VRGRCLT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-17	5	81	27	102	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250\|UniProtKB:O80883, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269\|PubMed:19714218}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU960450	6e-97	EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020182485.1	9e-51	transcription factor WER-like
Swissprot	Q94FL7	2e-33	MY120_ARATH; Transcription factor MYB120
TrEMBL	A0A3B6JNF7	1e-49	A0A3B6JNF7_WHEAT; Uncharacterized protein
TrEMBL	A0A453J5H3	4e-50	A0A453J5H3_AEGTS; Uncharacterized protein
STRING	Traes_4BL_F7B9CBA99.1	3e-57	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP13228	24	33

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24310.1	3e-40	myb domain protein 305

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]