| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 465.5 | 3.1e-142 | 52 | 436 | 1 | 374 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fs 85
lv++Ll+cAeav+++++++a+al++++ la+++g +m+++aayf eALa+r++r ++p+++s + ++++a+ l f+
Traes_4BS_2EE4988CD.1 52 LVHALLACAEAVQQENFSAAEALVKQIPLLAASQGGAMRKVAAYFGEALARRVFR--------FRPQPDS--SLLDAAFADLLhahFY 129
689****************************************************........5555555..34444444444456** PP
GRAS 86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelg 173
e +P+lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++
Traes_4BS_2EE4988CD.1 130 ESCPYLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIR 217
**************************************************************************************** PP
GRAS 174 vpfefnvlvakrledleleeLrvkp.......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
v+f+++ lva +l+dle+ +L+ + E++aVn+v+++hrll+++++le+ vL +v+ ++P++v+vveqea+hns++Fl
Traes_4BS_2EE4988CD.1 218 VDFQYRGLVAATLADLEPFMLQPEGeedpneePEVIAVNSVFEMHRLLAQPGALEK----VLGTVRAVRPRIVTVVEQEANHNSGTFL 301
*********************544444557789***********************....**************************** PP
GRAS 255 erflealeyysalfdsleak..............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
+rf+e+l+yys++fdsle + +p+++ +++++++++lgr+i+nvvacegaer+erhetl++Wr+rl++aGF++v+
Traes_4BS_2EE4988CD.1 302 DRFTESLHYYSTMFDSLEGGssggpsevssgaaaAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFETVH 389
*****************98889**********9999999************************************************* PP
GRAS 329 lsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
l+++a+kqa++ll+ ++ +dgy+vee++g+l+lgW++rpL+++SaWr
Traes_4BS_2EE4988CD.1 390 LGSNAYKQASTLLALFAgGDGYKVEEKEGCLTLGWHTRPLIATSAWR 436
**********************************************8 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0006808 | Biological Process | regulation of nitrogen utilization |
| GO:0009723 | Biological Process | response to ethylene |
| GO:0009737 | Biological Process | response to abscisic acid |
| GO:0009863 | Biological Process | salicylic acid mediated signaling pathway |
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway |
| GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway |
| GO:0010187 | Biological Process | negative regulation of seed germination |
| GO:0010218 | Biological Process | response to far red light |
| GO:0010233 | Biological Process | phloem transport |
| GO:0042538 | Biological Process | hyperosmotic salinity response |
| GO:2000033 | Biological Process | regulation of seed dormancy process |
| GO:2000377 | Biological Process | regulation of reactive oxygen species metabolic process |
| GO:0005634 | Cellular Component | nucleus |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | FM878945 | 0.0 | FM878945.1 Triticum aestivum Rht-Ble gene for mutated DELLA protein. |
| GenBank | FR668586 | 0.0 | FR668586.2 Triticum aestivum rht-B1 gene, allele a. |
| GenBank | FR719732 | 0.0 | FR719732.1 Triticum aestivum rht-B1a gene for DELLA protein. |
| GenBank | GQ451335 | 0.0 | GQ451335.2 Triticum aestivum cultivar Xiaoyan 54 truncated DELLA protein RHT-B1b gene, complete cds. |
| GenBank | JF930278 | 0.0 | JF930278.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1a allele, complete cds. |
| GenBank | JF930280 | 0.0 | JF930280.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1e allele, complete cds. |
| GenBank | JN857970 | 0.0 | JN857970.1 Triticum aestivum mutant DELLA protein gene, complete cds. |
| GenBank | JN857971 | 0.0 | JN857971.1 Triticum aestivum mutant DELLA protein mRNA, complete cds. |
| GenBank | KC614599 | 0.0 | KC614599.1 Triticum aestivum cultivar landrace bio-material INRA:24185 haplotype Rht-B1a_1 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614600 | 0.0 | KC614600.1 Triticum aestivum cultivar Palestinskaya bio-material INRA:24180 haplotype Rht-B1a_1 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614601 | 0.0 | KC614601.1 Triticum aestivum cultivar Rouge de Marchissy bio-material INRA:06318 haplotype Rht-B1a_1 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614610 | 0.0 | KC614610.1 Triticum aestivum cultivar Gaines bio-material JIC:814 haplotype Rht-B1a_8 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614611 | 0.0 | KC614611.1 Triticum aestivum cultivar Squarehead's Master bio-material JIC:8551 haplotype Rht-B1a_8 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614612 | 0.0 | KC614612.1 Triticum aestivum cultivar Xi19 bio-material NIAB EW11-3 haplotype Rht-B1a_8 DELLA protein (Rht-B1) gene, complete cds. |
| GenBank | KC614613 | 0.0 | KC614613.1 Triticum aestivum cultivar Norin10/Brevor-14 bio-material USDA:Cltr13253 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614614 | 0.0 | KC614614.1 Triticum aestivum cultivar Robigus bio-material NIAB EW66-3 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614615 | 0.0 | KC614615.1 Triticum aestivum cultivar Siete Cerros bio-material JIC:614 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614616 | 0.0 | KC614616.1 Triticum aestivum cultivar Soissons bio-material NIAB EW9 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614617 | 0.0 | KC614617.1 Triticum aestivum cultivar W7984 bio-material INRA:13812 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC767925 | 0.0 | KC767925.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1a allele, complete cds. |