![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4BS_481D51B66.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 161aa MW: 17213.4 Da PI: 10.154 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 97.4 | 1e-30 | 104 | 155 | 2 | 53 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
pr+rWt+ LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+Y
Traes_4BS_481D51B66.2 104 PRMRWTTALHAHFVQAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMY 155
9**************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-27 | 100 | 155 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 9.32E-16 | 101 | 157 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.8E-23 | 104 | 155 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.4E-8 | 105 | 156 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MATAADAPDL SLHISPPSPT GKAWSGRGDE MAISAESTEL CLGFDMATAR QSGEVRNGHS 60 DLEQRLHQPS QIPRFKKSSA DSQVGSSGGA ARSGNGGKKS SRAPRMRWTT ALHAHFVQAV 120 QLLGGHERAT PKSVLELMNV KDLTLAHVKS HLQMYLFLVA S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 7e-17 | 105 | 155 | 4 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020189915.1 | 1e-103 | probable transcription factor RL9 | ||||
| Swissprot | Q9FJV5 | 2e-33 | KAN4_ARATH; Probable transcription factor KAN4 | ||||
| TrEMBL | A0A3B6INT0 | 1e-109 | A0A3B6INT0_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446RU55 | 1e-109 | A0A446RU55_TRITD; Uncharacterized protein | ||||
| STRING | Traes_4BS_481D51B66.2 | 1e-115 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3742 | 31 | 68 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G42630.2 | 4e-32 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




