PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_4DL_26A958CDD.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB

Protein Properties

Length: 224aa MW: 24191.2 Da PI: 9.8569

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_4DL_26A958CDD.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.7	2.4e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ede l+ +vk +G g+Wk ++ + g++R++k+c++rw++yl Traes_4DL_26A958CDD.1 14 RGAWTSKEDETLASYVKAHGEGRWKQVPLKAGLRRCGKSCRLRWLNYL 61 89********************************************97 PP
2	Myb_DNA-binding	51.9	1.7e-16	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ Traes_4DL_26A958CDD.1 67 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111 7899****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.353	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	3.63E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.2E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-15	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.2E-23	15	68	IPR009057	Homeodomain-like
CDD	cd00167	1.80E-9	16	61	No hit	No description
PROSITE profile	PS51294	25.042	62	116	IPR017930	Myb domain
SMART	SM00717	5.8E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.0E-14	67	111	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.5E-23	69	115	IPR009057	Homeodomain-like
CDD	cd00167	1.36E-11	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006633	Biological Process	fatty acid biosynthetic process
GO:0006970	Biological Process	response to osmotic stress
GO:0010023	Biological Process	proanthocyanidin biosynthetic process
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MGRRAWSAKE GVKRGAWTSK EDETLASYVK AHGEGRWKQV PLKAGLRRCG KSCRLRWLNY 60 LRPSIKRGNI SDDEEELIVR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRKALPER 120 SATRMVSTPC ASPGSVSSNS GAATSSNAAT PPLSAAVWAP KPVRCTGGLF FHGDARAVGG 180 DGDECSGSSL VASSGGGDWM DDVRALASFL ESDDDWVNSL QMAG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-26	14	116	7	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK358937	0.0	AK358937.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1086B18.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020156286.1	1e-161	anthocyanin regulatory C1 protein-like
Swissprot	P10290	2e-76	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	W5EG13	1e-160	W5EG13_WHEAT; Ppm3
STRING	Traes_4DL_26A958CDD.1	1e-161	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	4e-56	MYB family protein

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]