PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_64E445D4A.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Trihelix
Protein Properties Length: 93aa    MW: 10375.7 Da    PI: 10.3917
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_64E445D4A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.51.3e-211691787
               trihelix 17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                           m+ ++r+++lk+plWe+vs++++e g +rs+k+C+ek+en+ k+y+++k+g+ +r  ++ +t+++f++lea
  Traes_4DL_64E445D4A.1  1 MDAAFREAALKGPLWEQVSRRLAEMGHTRSAKKCREKFENVDKYYRRTKDGRTGR--GDGKTYRFFTELEA 69
                           6889*************************************************97..77778******985 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122039.43E-16149No hitNo description
PfamPF138375.3E-16370No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MDAAFREAAL KGPLWEQVSR RLAEMGHTRS AKKCREKFEN VDKYYRRTKD GRTGRGDGKT  60
YRFFTELEAL HGASAAHHPQ PAHVAVAPPA APA
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3578236e-97AK357823.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1062I19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020163611.13e-49trihelix transcription factor GTL1-like
SwissprotQ9C8822e-29GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A453JDB31e-57A0A453JDB3_AEGTS; Uncharacterized protein
TrEMBLA0A453JDV15e-59A0A453JDV1_AEGTS; Uncharacterized protein
STRINGTraes_4DL_64E445D4A.17e-63(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.13e-18GT-2-like 1
Publications ? help Back to Top
  1. Caro E,Desvoyes B,Gutierrez C
    GTL1 keeps cell growth and nuclear ploidy under control.
    EMBO J., 2012. 31(24): p. 4483-5
    [PMID:23188085]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Zheng X, et al.
    The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development.
    Sci Rep, 2016. 6: p. 27042
    [PMID:27245096]
  4. Shibata M, et al.
    GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.
    Development, 2018.
    [PMID:29439132]